Description
Tesamorelin
Intended for laboratory research purposes only. Not for human consumption
Tesamorelin is a synthetic analog of human growth hormone-releasing hormone (GHRH), consisting of the 44-amino-acid sequence of native GHRH with an N-terminal trans-3-hexenoyl (hexenoyl) modification for enhanced stability and potency.
Key Chemical Details:
- CAS Number: 218949-48-5 (free base; acetate salt often 901758-09-6)
- Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S
- Molecular Weight: 5135.86–5136 g/mol (commonly listed as 5135.86 or 5136; exact monoisotopic mass ≈5132.72 Da for free base)
- Amino Acid Sequence (one-letter code): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (with N-terminal trans-3-hexenoyl modification and C-terminal amidation)
- Full sequence (three-letter code): trans-3-Hexenoyl-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH₂
- N-terminal: trans-3-Hexenoyl-Tyr; C-terminal: Amidated Leucine (Leu-NH₂)
- IUPAC/Full Chemical Name: (Complex systematic name; e.g., (4S)-4-[[2-[[(2S)-5-amino-2-[[…]] (very long due to 44-residue chain; refers to the full branched peptide with hexenoyl at N-terminus; see PubChem for complete string)
- PubChem CID: 16137828 (primary for Tesamorelin free base; related entries for acetate salt)
- Appearance (typical research grade): White to off-white lyophilized powder
- Solubility: Readily soluble in water or aqueous buffers (typically reconstitutes in sterile water for research use)
- Storage: Typically -20°C (as lyophilized powder for stability); avoid repeated freeze-thaw cycles and light exposure
- Other Properties:
- Modified GHRH analog with N-terminal acylation for resistance to DPP-IV degradation and prolonged activity
- High molecular weight and polarity from extensive peptide chain with multiple charged (Arg, Lys, Asp, Glu) and polar residues
- Contains one methionine (Met) residue (contributing to S in formula)
- Sensitive to proteases (enhanced stability vs. native GHRH), heat, light, and improper pH
Disclaimers
- Strictly for qualified laboratory research professionals.
- Not FDA-approved in this context; no therapeutic, diagnostic, or human-use applications.
- Purity typically ≥98–99% (HPLC); batch-specific third-party Certificates of Analysis (COAs) available for identity, purity, and contaminants.
- Handle according to standard lab safety protocols.
Shipping & Delivery
